Lineage for d2m9aa1 (2m9a A:12-98)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035526Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 3035527Protein automated matches [196455] (4 species)
    not a true protein
  7. 3035532Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)
  8. 3035536Domain d2m9aa1: 2m9a A:12-98 [264384]
    Other proteins in same PDB: d2m9aa2
    automated match to d2rsja_
    complexed with zn

Details for d2m9aa1

PDB Entry: 2m9a (more details)

PDB Description: Solution NMR Structure of E3 ubiquitin-protein ligase ZFP91 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7784A
PDB Compounds: (A:) E3 ubiquitin-protein ligase ZFP91

SCOPe Domain Sequences for d2m9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m9aa1 g.37.1.0 (A:12-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdyiceycarafksshnlavhrmihtgekplqceicgftcrqkaslnwhmkkhdadsfyq
fscnicgkkfekkdsvvahkakshpev

SCOPe Domain Coordinates for d2m9aa1:

Click to download the PDB-style file with coordinates for d2m9aa1.
(The format of our PDB-style files is described here.)

Timeline for d2m9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m9aa2