Lineage for d2m6sa_ (2m6s A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116094Species Escherichia coli [TaxId:469008] [267794] (2 PDB entries)
  8. 2116095Domain d2m6sa_: 2m6s A: [264383]
    automated match to d2hnba_
    complexed with fmn

Details for d2m6sa_

PDB Entry: 2m6s (more details)

PDB Description: holo_yqca
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2m6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m6sa_ c.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 469008]}
maeigifvgtmygnsllvaeeaeailtaqghkatvfedpelsdwlpyqdkyvlvvtsttg
qgdlpdsivplfqgikdslgfqpnlrygvialgdssyvnfcnggkqfdallqeqsaqrvg
emllidasenpepetesnpwvehwgtlls

SCOPe Domain Coordinates for d2m6sa_:

Click to download the PDB-style file with coordinates for d2m6sa_.
(The format of our PDB-style files is described here.)

Timeline for d2m6sa_: