Lineage for d2m68a_ (2m68 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397805Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2397806Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2397807Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 protein domains)
  6. 2397865Protein automated matches [254500] (3 species)
    not a true protein
  7. 2397868Species Human (Homo sapiens) [TaxId:9606] [255090] (5 PDB entries)
  8. 2397871Domain d2m68a_: 2m68 A: [264380]
    automated match to d2m6ta_
    mutant

Details for d2m68a_

PDB Entry: 2m68 (more details)

PDB Description: nmr solution structure ensemble of 3-4d mutant domain 11 igf2r in complex with igf2 (domain 11 structure only)
PDB Compounds: (A:) Insulin-like growth factor 2 receptor variant

SCOPe Domain Sequences for d2m68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m68a_ b.64.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksnehddcqvtnpstghlfdlsslsgragftaayakgwgvymsicgenencppgvgacf
gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
sldkqtctlffswhtplacela

SCOPe Domain Coordinates for d2m68a_:

Click to download the PDB-style file with coordinates for d2m68a_.
(The format of our PDB-style files is described here.)

Timeline for d2m68a_: