![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
![]() | Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries) |
![]() | Domain d1e79e2: 1e79 E:9-81 [26438] Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d3, d1e79e1, d1e79e3, d1e79f1, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_ |
PDB Entry: 1e79 (more details), 2.4 Å
SCOP Domain Sequences for d1e79e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79e2 b.49.1.1 (E:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1e79e2: