Lineage for d2lxca1 (2lxc A:73-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933120Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)
  8. 2933130Domain d2lxca1: 2lxc A:73-151 [264379]
    Other proteins in same PDB: d2lxca2
    automated match to d2dzia_

Details for d2lxca1

PDB Entry: 2lxc (more details)

PDB Description: Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain
PDB Compounds: (A:) ubiquitin-like protein mdy2

SCOPe Domain Sequences for d2lxca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxca1 d.15.1.0 (A:73-151) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl
sdlkvtpanstitvmikpn

SCOPe Domain Coordinates for d2lxca1:

Click to download the PDB-style file with coordinates for d2lxca1.
(The format of our PDB-style files is described here.)

Timeline for d2lxca1: