SCOPe 2.07: Domain d2lxca1: 2lxc A:73-151

Lineage for d2lxca1 (2lxc A:73-151)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)

8. Domain d2lxca1: 2lxc A:73-151 [264379]
   Other proteins in same PDB: d2lxca2
   automated match to d2dzia_

Details for d2lxca1

PDB Entry: 2lxc

PDB Description: Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain

PDB Compounds: (A:) ubiquitin-like protein mdy2

SCOPe Domain Sequences for d2lxca1:

Sequence; same for both SEQRES and ATOM records:

>d2lxca1 d.15.1.0 (A:73-151) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl
sdlkvtpanstitvmikpn

Timeline for d2lxca1:

• d2lxca1 first appeared in SCOPe 2.05, called d2lxca_
  
• d2lxca1 appears in SCOPe 2.06