![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries) |
![]() | Domain d2lxca1: 2lxc A:73-151 [264379] Other proteins in same PDB: d2lxca2 automated match to d2dzia_ |
PDB Entry: 2lxc (more details)
SCOPe Domain Sequences for d2lxca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lxca1 d.15.1.0 (A:73-151) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl sdlkvtpanstitvmikpn
Timeline for d2lxca1: