Lineage for d2lqoa_ (2lqo A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855243Species Mycobacterium tuberculosis [TaxId:1773] [187835] (4 PDB entries)
  8. 1855245Domain d2lqoa_: 2lqo A: [264374]
    automated match to d4tr0a_

Details for d2lqoa_

PDB Entry: 2lqo (more details)

PDB Description: Mrx1 reduced
PDB Compounds: (A:) Putative glutaredoxin Rv3198.1/MT3292

SCOPe Domain Sequences for d2lqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lqoa_ c.47.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvtaaltiyttswcgyclrlktaltanriaydevdiehnraaaefvgsvnggnrtvptvk
fadgstltnpsadevkaklvkiaglehh

SCOPe Domain Coordinates for d2lqoa_:

Click to download the PDB-style file with coordinates for d2lqoa_.
(The format of our PDB-style files is described here.)

Timeline for d2lqoa_: