Lineage for d2llna_ (2lln A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771160Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)
  8. 2771207Domain d2llna_: 2lln A: [264372]
    automated match to d2fwlb_

Details for d2llna_

PDB Entry: 2lln (more details)

PDB Description: Solution structure of Thermus thermophilus apo-CuA
PDB Compounds: (A:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2llna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2llna_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
mvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgae
ivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfg
tivvke

SCOPe Domain Coordinates for d2llna_:

Click to download the PDB-style file with coordinates for d2llna_.
(The format of our PDB-style files is described here.)

Timeline for d2llna_: