Lineage for d2lksa_ (2lks A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735563Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2735580Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 2735581Family a.159.2.1: FF domain [81699] (4 proteins)
  6. 2735594Protein automated matches [254579] (1 species)
    not a true protein
  7. 2735595Species Human (Homo sapiens) [TaxId:9606] [255349] (4 PDB entries)
  8. 2735598Domain d2lksa_: 2lks A: [264371]
    automated match to d2kzga_

Details for d2lksa_

PDB Entry: 2lks (more details)

PDB Description: Ff11-60
PDB Compounds: (A:) Pre-mRNA-processing factor 40 homolog A

SCOPe Domain Sequences for d2lksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lksa_ a.159.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkeeakqafkellkekrvpsnasweqamkmiindprysalakls

SCOPe Domain Coordinates for d2lksa_:

Click to download the PDB-style file with coordinates for d2lksa_.
(The format of our PDB-style files is described here.)

Timeline for d2lksa_: