![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (29 species) not a true protein |
![]() | Species Anaplasma phagocytophilum [TaxId:212042] [267793] (1 PDB entry) |
![]() | Domain d2l4ba1: 2l4b A:6-88 [264367] Other proteins in same PDB: d2l4ba2 automated match to d2kwla_ |
PDB Entry: 2l4b (more details)
SCOPe Domain Sequences for d2l4ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l4ba1 a.28.1.0 (A:6-88) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} seeikaqvmesvigclklndeqkqilsgttnlakdfnldsldfvdlimsleerfsleisd edaqkletvddicryiaskssda
Timeline for d2l4ba1: