SCOPe 2.07: Domain d2l4ba1: 2l4b A:6-88

Lineage for d2l4ba1 (2l4b A:6-88)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (20 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:212042] [267793] (1 PDB entry)

8. Domain d2l4ba1: 2l4b A:6-88 [264367]
   Other proteins in same PDB: d2l4ba2
   automated match to d2kwla_

Details for d2l4ba1

PDB Entry: 2l4b

PDB Description: Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2l4ba1:

Sequence; same for both SEQRES and ATOM records:

>d2l4ba1 a.28.1.0 (A:6-88) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
seeikaqvmesvigclklndeqkqilsgttnlakdfnldsldfvdlimsleerfsleisd
edaqkletvddicryiaskssda

Timeline for d2l4ba1:

• d2l4ba1 first appeared in SCOPe 2.05, called d2l4ba_
  
• d2l4ba1 appears in SCOPe 2.06