Lineage for d2l4ba1 (2l4b A:6-88)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706253Species Anaplasma phagocytophilum [TaxId:212042] [267793] (1 PDB entry)
  8. 2706254Domain d2l4ba1: 2l4b A:6-88 [264367]
    Other proteins in same PDB: d2l4ba2
    automated match to d2kwla_

Details for d2l4ba1

PDB Entry: 2l4b (more details)

PDB Description: solution structure of a putative acyl carrier protein from anaplasma phagocytophilum. seattle structural genomics center for infectious disease target anpha.01018.a
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2l4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l4ba1 a.28.1.0 (A:6-88) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
seeikaqvmesvigclklndeqkqilsgttnlakdfnldsldfvdlimsleerfsleisd
edaqkletvddicryiaskssda

SCOPe Domain Coordinates for d2l4ba1:

Click to download the PDB-style file with coordinates for d2l4ba1.
(The format of our PDB-style files is described here.)

Timeline for d2l4ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l4ba2