Lineage for d2kxfa1 (2kxf A:102-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952627Domain d2kxfa1: 2kxf A:102-200 [264362]
    Other proteins in same PDB: d2kxfa3
    automated match to d2mpua_

Details for d2kxfa1

PDB Entry: 2kxf (more details)

PDB Description: solution structure of the first two rrm domains of fbp-interacting repressor (fir)
PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d2kxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kxfa1 d.58.7.0 (A:102-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafveye
vpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidq

SCOPe Domain Coordinates for d2kxfa1:

Click to download the PDB-style file with coordinates for d2kxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2kxfa1: