SCOPe 2.05: Domain d2kwba_: 2kwb A:

Lineage for d2kwba_ (2kwb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.0: automated matches [267622] (1 protein)
   not a true family

6. Protein automated matches [267669] (1 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [267792] (2 PDB entries)

8. Domain d2kwba_: 2kwb A: [264361]
   automated match to d2hr9a_

Details for d2kwba_

PDB Entry: 2kwb

PDB Description: minimal constraint solution nmr structure of translationally- controlled tumor protein (tctp) from c.elegans, northeast structural genomics consortium target wr73

PDB Compounds: (A:) Translationally-controlled tumor protein homolog

SCOPe Domain Sequences for d2kwba_:

Sequence; same for both SEQRES and ATOM records:

>d2kwba_ b.88.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mliykdiftddelssdsfpmklvddlvyefkgkhvvrkegeivlagsnpsaeegaeddgs
dehvergidivlnhklvemncyedasmfkayikkfmknvidhmeknnrdkadvdafkkki
qgwvvsllakdrfknlaffigeraaegaengqvaiieyrdvdgtevptlmlvkeaiieek
cle

Timeline for d2kwba_:

• d2kwba_ is new in SCOPe 2.05-stable
  
• d2kwba_ is called d2kwba1 in SCOPe 2.06
  
• d2kwba_ appears in the current release, SCOPe 2.08, called d2kwba1