Lineage for d2krfb_ (2krf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695328Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries)
  8. 2695332Domain d2krfb_: 2krf B: [264360]
    automated match to d2rnja_

Details for d2krfb_

PDB Entry: 2krf (more details)

PDB Description: nmr solution structure of the dna binding domain of competence protein a
PDB Compounds: (B:) Transcriptional regulatory protein comA

SCOPe Domain Sequences for d2krfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2krfb_ a.4.6.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteav
liaksdgvl

SCOPe Domain Coordinates for d2krfb_:

Click to download the PDB-style file with coordinates for d2krfb_.
(The format of our PDB-style files is described here.)

Timeline for d2krfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2krfa_