| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
| Protein automated matches [190858] (25 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries) |
| Domain d2krfb_: 2krf B: [264360] automated match to d2rnja_ |
PDB Entry: 2krf (more details)
SCOPe Domain Sequences for d2krfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2krfb_ a.4.6.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteav
liaksdgvl
Timeline for d2krfb_: