SCOPe 2.08: Domain d2krfa_: 2krf A:

Lineage for d2krfa_ (2krf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries)

8. Domain d2krfa_: 2krf A: [264359]
   automated match to d2rnja_

Details for d2krfa_

PDB Entry: 2krf

PDB Description: nmr solution structure of the dna binding domain of competence protein a

PDB Compounds: (A:) Transcriptional regulatory protein comA

SCOPe Domain Sequences for d2krfa_:

Sequence; same for both SEQRES and ATOM records:

>d2krfa_ a.4.6.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteav
liaksdgvl

Timeline for d2krfa_:

• d2krfa_ first appeared in SCOPe 2.05
  
• d2krfa_ appears in SCOPe 2.07