Lineage for d2kn2a1 (2kn2 A:4-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711814Species Soybean (Glycine max) [TaxId:3847] [255586] (2 PDB entries)
  8. 2711816Domain d2kn2a1: 2kn2 A:4-75 [264356]
    Other proteins in same PDB: d2kn2a2, d2kn2a3
    automated match to d2roba_
    complexed with ca

Details for d2kn2a1

PDB Entry: 2kn2 (more details)

PDB Description: solution structure of the c-terminal domain of soybean calmodulin isoform 4 fused with the calmodulin-binding domain of ntmkp1
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2kn2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kn2a1 a.39.1.0 (A:4-75) automated matches {Soybean (Glycine max) [TaxId: 3847]}
dtdaeeelkeafkvfdkdqngyisaselrhvminlgekltdeeveqmikeadldgdgqvn
yeefvkmmmtvr

SCOPe Domain Coordinates for d2kn2a1:

Click to download the PDB-style file with coordinates for d2kn2a1.
(The format of our PDB-style files is described here.)

Timeline for d2kn2a1: