SCOPe 2.08: Domain d2kkob1: 2kko B:1-100

Lineage for d2kkob1 (2kko B:1-100)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Mycobacterium bovis [TaxId:233413] [255852] (2 PDB entries)

8. Domain d2kkob1: 2kko B:1-100 [264355]
   Other proteins in same PDB: d2kkoa2, d2kkob2
   automated match to d3gw2a_

Details for d2kkob1

PDB Entry: 2kko

PDB Description: solution nmr structure of the homodimeric winged helix-turn-helix dna- binding domain (fragment 1-100) mb0332 from mycobacterium bovis, a possible arsr-family transcriptional regulator. northeast structural genomics consortium target mbr242e.

PDB Compounds: (B:) possible transcriptional regulatory protein (possibly arsr-family)

SCOPe Domain Sequences for d2kkob1:

Sequence; same for both SEQRES and ATOM records:

>d2kkob1 a.4.5.0 (B:1-100) automated matches {Mycobacterium bovis [TaxId: 233413]}
magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
alksgglvearregtrqyyriagedvarlfalvqvvadeh

Timeline for d2kkob1:

• d2kkob1 first appeared in SCOPe 2.05, called d2kkob_
  
• d2kkob1 appears in SCOPe 2.07