SCOPe 2.06: Domain d2kgja1: 2kgj A:1-94

Lineage for d2kgja1 (2kgj A:1-94)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267790] (1 PDB entry)

8. Domain d2kgja1: 2kgj A:1-94 [264351]
   Other proteins in same PDB: d2kgja2
   automated match to d1zk6a_

Details for d2kgja1

PDB Entry: 2kgj

PDB Description: solution structure of parvulin domain of ppid from e.coli

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase D

SCOPe Domain Sequences for d2kgja1:

Sequence; same for both SEQRES and ATOM records:

>d2kgja1 d.26.1.0 (A:1-94) automated matches {Escherichia coli [TaxId: 83333]}
tqpqrtrysiiqtktedeakavldelnkggdfaalakeksadiisarnggdmgwledati
pdelknaglkekgqlsgvikssvgflivrlddiq

Timeline for d2kgja1:

• d2kgja1 first appeared in SCOPe 2.05, called d2kgja_
  
• d2kgja1 appears in SCOPe 2.07
  
• d2kgja1 appears in the current release, SCOPe 2.08