| Class b: All beta proteins [48724] (141 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries) |
| Domain d1e79b2: 1e79 B:19-94 [26435] Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_ |
PDB Entry: 1e79 (more details), 2.4 Å
SCOP Domain Sequences for d1e79b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79b2 b.49.1.1 (B:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai
Timeline for d1e79b2: