Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries) |
Domain d2kfya_: 2kfy A: [264349] automated match to d2kg0a_ protein/RNA complex |
PDB Entry: 2kfy (more details)
SCOPe Domain Sequences for d2kfya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kfya_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mmlgpeggegfvvklrglpwscsvedvqnflsdctihdgaagvhfiytregrqsgeafve lgseddvkmalkkdresmghryievfkshrtemdwvlkhsgp
Timeline for d2kfya_: