SCOPe 2.05: Domain d2jrza_: 2jrz A:

Lineage for d2jrza_ (2jrz A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.3: ARID-like [46774] (2 families)
   contains extra helices at both N- and C-termini

5. Family a.4.3.0: automated matches [254231] (1 protein)
   not a true family

6. Protein automated matches [254522] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267787] (1 PDB entry)

8. Domain d2jrza_: 2jrz A: [264341]
   automated match to d2eqya_

Details for d2jrza_

PDB Entry: 2jrz

PDB Description: solution structure of the bright/arid domain from the human jarid1c protein.

PDB Compounds: (A:) Histone demethylase JARID1C

SCOPe Domain Sequences for d2jrza_:

Sequence; same for both SEQRES and ATOM records:

>d2jrza_ a.4.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smneleaqtrvklnyldqiakfweiqgsslkipnverrildlyslskivveeggyeaick
drrwarvaqrlnyppgknigsllrshyerivypyemyqsganlvcntrpfdneekdk

Timeline for d2jrza_:

• d2jrza_ is new in SCOPe 2.05-stable
  
• d2jrza_ is called d2jrza1 in SCOPe 2.06
  
• d2jrza_ appears in the current release, SCOPe 2.08, called d2jrza1