Lineage for d2jpca_ (2jpc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2307689Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2307775Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2307776Protein automated matches [190858] (18 species)
    not a true protein
  7. 2307829Species Salmonella typhimurium [TaxId:602] [267786] (1 PDB entry)
  8. 2307830Domain d2jpca_: 2jpc A: [264340]
    automated match to d2rnja_

Details for d2jpca_

PDB Entry: 2jpc (more details)

PDB Description: SSRB DNA Binding Protein
PDB Compounds: (A:) SsrB

SCOPe Domain Sequences for d2jpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jpca_ a.4.6.0 (A:) automated matches {Salmonella typhimurium [TaxId: 602]}
lrerqvlklidegytnhgiseklhisiktvethrmnmmrklqvhkvtellncarrmrlie
y

SCOPe Domain Coordinates for d2jpca_:

Click to download the PDB-style file with coordinates for d2jpca_.
(The format of our PDB-style files is described here.)

Timeline for d2jpca_: