SCOPe 2.06: Domain d2jlme_: 2jlm E:

Lineage for d2jlme_ (2jlm E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Acinetobacter baylyi [TaxId:202950] [267785] (1 PDB entry)

8. Domain d2jlme_: 2jlm E: [264338]
   automated match to d4mbub_
   complexed with act, azi, na, peg

Details for d2jlme_

PDB Entry: 2jlm, 2.35 Å

PDB Description: structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1

PDB Compounds: (E:) putative phosphinothricin n-acetyltransferase

SCOPe Domain Sequences for d2jlme_:

Sequence; same for both SEQRES and ATOM records:

>d2jlme_ d.108.1.0 (E:) automated matches {Acinetobacter baylyi [TaxId: 202950]}
pstttlfrfvectedqhaleileilndaiinstalydykprskesmaawfatkrqnnfpi
igavnevgqllgfaswgsfrafpaykytvehsvyihkdyrglglskhlmnelikravese
vhvmvgcidatnvasiqlhqklgfihsgtiqqagfkfgrwldaafyqltldtplhpqdd

Timeline for d2jlme_:

• d2jlme_ first appeared in SCOPe 2.05
  
• d2jlme_ appears in SCOPe 2.07
  
• d2jlme_ appears in the current release, SCOPe 2.08