![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Acinetobacter baylyi [TaxId:202950] [267785] (1 PDB entry) |
![]() | Domain d2jlmd_: 2jlm D: [264337] automated match to d4mbub_ complexed with act, azi, na, peg |
PDB Entry: 2jlm (more details), 2.35 Å
SCOPe Domain Sequences for d2jlmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlmd_ d.108.1.0 (D:) automated matches {Acinetobacter baylyi [TaxId: 202950]} mfspstttlfrfvectedqhaleileilndaiinstalydykprskesmaawfatkrqnn fpiigavnevgqllgfaswgsfrafpaykytvehsvyihkdyrglglskhlmnelikrav esevhvmvgcidatnvasiqlhqklgfihsgtiqqagfkfgrwldaafyqltldtplhpq dd
Timeline for d2jlmd_: