SCOPe 2.07: Domain d2jlmc_: 2jlm C:

Lineage for d2jlmc_ (2jlm C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Acinetobacter baylyi [TaxId:202950] [267785] (1 PDB entry)

8. Domain d2jlmc_: 2jlm C: [264336]
   automated match to d4mbub_
   complexed with act, azi, na, peg

Details for d2jlmc_

PDB Entry: 2jlm, 2.35 Å

PDB Description: structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1

PDB Compounds: (C:) putative phosphinothricin n-acetyltransferase

SCOPe Domain Sequences for d2jlmc_:

Sequence; same for both SEQRES and ATOM records:

>d2jlmc_ d.108.1.0 (C:) automated matches {Acinetobacter baylyi [TaxId: 202950]}
tttlfrfvectedqhaleileilndaiinstalydykprskesmaawfatkrqnnfpiig
avnevgqllgfaswgsfrafpaykytvehsvyihkdyrglglskhlmnelikravesevh
vmvgcidatnvasiqlhqklgfihsgtiqqagfkfgrwldaafyqltldtplhpqdd

Timeline for d2jlmc_:

• d2jlmc_ first appeared in SCOPe 2.05
  
• d2jlmc_ appears in SCOPe 2.06
  
• d2jlmc_ appears in the current release, SCOPe 2.08