Lineage for d2jk6b1 (2jk6 B:1-169,B:287-358)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833443Protein Trypanothione reductase [51947] (3 species)
  7. 1833473Species Leishmania infantum [TaxId:5671] [267748] (1 PDB entry)
  8. 1833476Domain d2jk6b1: 2jk6 B:1-169,B:287-358 [264331]
    Other proteins in same PDB: d2jk6a3, d2jk6b3
    automated match to d2jk6a1
    complexed with fad, so4

Details for d2jk6b1

PDB Entry: 2jk6 (more details), 2.95 Å

PDB Description: structure of trypanothione reductase from leishmania infantum
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d2jk6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jk6b1 c.3.1.5 (B:1-169,B:287-358) Trypanothione reductase {Leishmania infantum [TaxId: 5671]}
msraydlvvlgagsggleagwnaavthkkkvavvdvqathgpplfaalggtcvnvgcvpk
klmvtgaqymdliresggfgwemdreslcpnwktliaaknkvvnsinesyksmfadtegl
sfhmgfgalqdahtvvvrksedphsdvletldteyiliatgswptrlgvXrvprsqalql
dkagvrtgkngavqvdaysktsvdniyaigdvtnrvmltpvainegaafvetvfggkpra
td

SCOPe Domain Coordinates for d2jk6b1:

Click to download the PDB-style file with coordinates for d2jk6b1.
(The format of our PDB-style files is described here.)

Timeline for d2jk6b1: