Lineage for d2jema_ (2jem A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781871Species Bacillus licheniformis [TaxId:1402] [255255] (2 PDB entries)
  8. 1781873Domain d2jema_: 2jem A: [264326]
    automated match to d2jena_

Details for d2jema_

PDB Entry: 2jem (more details), 1.78 Å

PDB Description: native family 12 xyloglucanase from bacillus licheniformis
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d2jema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jema_ b.29.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
asssnpsdklyfknkkyyifnnvwgadqvsgwwqtiyhnsdsdmgwvwnwpsntstvkay
psivsgwhwtegytagsgfptrlsdqknintkvsysisangtynaaydiwlhntnkaswd
saptdqimiwlnntnagpagsyvetvsigghswkvykgyidagggkgwnvfsfirtantq
sanlnirdftnyladskqwlsktkyvssvefgtevfggtgqinisnwdvtvr

SCOPe Domain Coordinates for d2jema_:

Click to download the PDB-style file with coordinates for d2jema_.
(The format of our PDB-style files is described here.)

Timeline for d2jema_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jemb_