| Class g: Small proteins [56992] (100 folds) |
| Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily) duplication; dimetal(zinc)-bound fold with little secondary structure |
Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) ![]() Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137) |
| Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins) |
| Protein Zn finger domain from mixed lineage leukemia (MLL) protein [267655] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [267730] (2 PDB entries) |
| Domain d2j2sa_: 2j2s A: [264322] complexed with zn |
PDB Entry: 2j2s (more details)
SCOPe Domain Sequences for d2j2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2sa_ g.95.1.1 (A:) Zn finger domain from mixed lineage leukemia (MLL) protein {Human (Homo sapiens) [TaxId: 9606]}
ggsvkkgrrsrrcgqcpgcqvpedcgvctncldkpkfggrnikkqcckmrkcqnlqwmps
kaylqkqakavk
Timeline for d2j2sa_: