Lineage for d2j2sa_ (2j2s A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038986Fold g.95: bi-CXXC zinc finger-like [267591] (1 superfamily)
    duplication; dimetal(zinc)-bound fold with little secondary structure
  4. 3038987Superfamily g.95.1: bi-CXXC zinc finger-like [267601] (1 family) (S)
    Pfam PF02008; PubMed 21507349 suggests it is a duplication of the mono-CXXC domain, which is homologous to the Zn-finger subdomain of alcohol dehydrogenase (50137)
  5. 3038988Family g.95.1.1: bi-CXXC zinc finger-like [267617] (3 proteins)
  6. 3038995Protein Zn finger domain from mixed lineage leukemia (MLL) protein [267655] (1 species)
  7. 3038996Species Human (Homo sapiens) [TaxId:9606] [267730] (2 PDB entries)
  8. 3038997Domain d2j2sa_: 2j2s A: [264322]
    complexed with zn

Details for d2j2sa_

PDB Entry: 2j2s (more details)

PDB Description: solution structure of the nonmethyl-cpg-binding cxxc domain of the leukaemia-associated mll histone methyltransferase
PDB Compounds: (A:) Zinc finger protein HRX

SCOPe Domain Sequences for d2j2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2sa_ g.95.1.1 (A:) Zn finger domain from mixed lineage leukemia (MLL) protein {Human (Homo sapiens) [TaxId: 9606]}
ggsvkkgrrsrrcgqcpgcqvpedcgvctncldkpkfggrnikkqcckmrkcqnlqwmps
kaylqkqakavk

SCOPe Domain Coordinates for d2j2sa_:

Click to download the PDB-style file with coordinates for d2j2sa_.
(The format of our PDB-style files is described here.)

Timeline for d2j2sa_: