| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
| Protein automated matches [190475] (10 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267784] (1 PDB entry) |
| Domain d2j16b_: 2j16 B: [264321] automated match to d2g6zb_ complexed with mg, so4 |
PDB Entry: 2j16 (more details), 2.7 Å
SCOPe Domain Sequences for d2j16b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j16b_ c.45.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
riypkgpllvlpekiylyseptvkellpfdvvinvaeeandlrmqvpaveyhhyrwehds
qialdlpsltsiihaattkrekilihcqcglsrsatliiayimkyhnlslrhsydllksr
adkinpsiglifqlmewevalnak
Timeline for d2j16b_: