SCOPe 2.05: Domain d2j16a_: 2j16 A:

Lineage for d2j16a_ (2j16 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267784] (1 PDB entry)

8. Domain d2j16a_: 2j16 A: [264320]
   automated match to d2g6zb_
   complexed with mg, so4

Details for d2j16a_

PDB Entry: 2j16, 2.7 Å

PDB Description: apo & sulphate bound forms of sdp-1

PDB Compounds: (A:) tyrosine-protein phosphatase yil113w

SCOPe Domain Sequences for d2j16a_:

Sequence, based on SEQRES records:

>d2j16a_ c.45.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypkgpllvlpekiylyseptvkellpfdvvinvaeeandlrmqvpaveyhhyrwehdsqi
aldlpsltsiihaattkrekilihcqcglsrsatliiayimkyhnlslrhsydllksrad
kinpsiglifqlmewevalnak

Sequence, based on observed residues (ATOM records):

>d2j16a_ c.45.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypkgpllvlpekiylyseptvkellpfdvvinvaeeaaveyhhyrwehdsqialdlpslt
siihaattkrekilihcqcglsrsatliiayimkyhnlslrhsydllksradkinpsigl
ifqlmewevalnak

Timeline for d2j16a_:

• d2j16a_ is new in SCOPe 2.05-stable
  
• d2j16a_ appears in SCOPe 2.06
  
• d2j16a_ appears in the current release, SCOPe 2.08