SCOP 1.55: Domain d1bcma1: 1bcm A:481-560

Lineage for d1bcma1 (1bcm A:481-560)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.48: mu transposase, C-terminal domain [50609] (1 superfamily)

4. Superfamily b.48.1: mu transposase, C-terminal domain [50610] (1 family)

5. Family b.48.1.1: mu transposase, C-terminal domain [50611] (1 protein)

6. Protein mu transposase, C-terminal domain [50612] (1 species)

7. Species Bacteriophage mu [TaxId:10677] [50613] (2 PDB entries)

8. Domain d1bcma1: 1bcm A:481-560 [26432]
   Other proteins in same PDB: d1bcma2, d1bcmb2

Details for d1bcma1

PDB Entry: 1bcm, 2.8 Å

PDB Description: bacteriophage mu transposase core domain with 2 monomers per asymmetric unit

SCOP Domain Sequences for d1bcma1:

Sequence; same for both SEQRES and ATOM records:

>d1bcma1 b.48.1.1 (A:481-560) mu transposase, C-terminal domain {Bacteriophage mu}
teeqkrmlllpaeavnvsrkgeftlkvggslkgaknvyynmalmnagvkkvvvrfdpqql
hstvycytldgrficeaecl

Timeline for d1bcma1:

• d1bcma1 appears in SCOP 1.57
  
• d1bcma1 appears in the current release, SCOPe 2.08