SCOPe 2.06: Domain d2iepb2: 2iep B:119-211

Lineage for d2iepb2 (2iep B:119-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (8 PDB entries)

8. Domain d2iepb2: 2iep B:119-211 [264315]
   automated match to d4c4ko_
   complexed with so4

Details for d2iepb2

PDB Entry: 2iep, 2.21 Å

PDB Description: crystal structure of immunoglobulin-like domains 1 and 2 of the receptor tyrosine kinase musk

PDB Compounds: (B:) Muscle-specific kinase receptor

SCOPe Domain Sequences for d2iepb2:

Sequence; same for both SEQRES and ATOM records:

>d2iepb2 b.1.1.0 (B:119-211) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mkpkitrppinvkiieglkavlpcttmgnpkpsvswikgdsalrensriavlesgslrih
nvqkedagqyrcvaknslgtaysklvklevevf

Timeline for d2iepb2:

• d2iepb2 first appeared in SCOPe 2.05
  
• d2iepb2 appears in SCOPe 2.07
  
• d2iepb2 appears in the current release, SCOPe 2.08