SCOPe 2.08: Domain d2iepa1: 2iep A:24-118

Lineage for d2iepa1 (2iep A:24-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d2iepa1: 2iep A:24-118 [264312]
   automated match to d4c4ko_
   complexed with so4

Details for d2iepa1

PDB Entry: 2iep, 2.21 Å

PDB Description: crystal structure of immunoglobulin-like domains 1 and 2 of the receptor tyrosine kinase musk

PDB Compounds: (A:) Muscle-specific kinase receptor

SCOPe Domain Sequences for d2iepa1:

Sequence; same for both SEQRES and ATOM records:

>d2iepa1 b.1.1.0 (A:24-118) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpkapvittpletvdalveevatfmcavesypqpeiswtrnkiliklfdtrysirengql
ltilsvedsddgiycctanngvggavescgalqvk

Timeline for d2iepa1:

• d2iepa1 first appeared in SCOPe 2.05
  
• d2iepa1 appears in SCOPe 2.07