![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.48: mu transposase, C-terminal domain [50609] (1 superfamily) barrel; n=6, S=8, greek-key |
![]() | Superfamily b.48.1: mu transposase, C-terminal domain [50610] (1 family) ![]() automatically mapped to Pfam PF09299 |
![]() | Family b.48.1.1: mu transposase, C-terminal domain [50611] (1 protein) |
![]() | Protein mu transposase, C-terminal domain [50612] (1 species) |
![]() | Species Bacteriophage Mu [TaxId:10677] [50613] (2 PDB entries) |
![]() | Domain d1bcoa1: 1bco A:481-560 [26431] Other proteins in same PDB: d1bcoa2 |
PDB Entry: 1bco (more details), 2.4 Å
SCOPe Domain Sequences for d1bcoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcoa1 b.48.1.1 (A:481-560) mu transposase, C-terminal domain {Bacteriophage Mu [TaxId: 10677]} teeqkrmlllpaeavnvsrkgeftlkvggslkgaknvyynmalmnagvkkvvvrfdpqql hstvycytldgrficeaecl
Timeline for d1bcoa1: