SCOPe 2.06: Domain d1bcoa1: 1bco A:481-560

Lineage for d1bcoa1 (1bco A:481-560)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.48: mu transposase, C-terminal domain [50609] (1 superfamily)
   barrel; n=6, S=8, greek-key

4. Superfamily b.48.1: mu transposase, C-terminal domain [50610] (1 family)
   automatically mapped to Pfam PF09299

5. Family b.48.1.1: mu transposase, C-terminal domain [50611] (1 protein)

6. Protein mu transposase, C-terminal domain [50612] (1 species)

7. Species Bacteriophage Mu [TaxId:10677] [50613] (2 PDB entries)

8. Domain d1bcoa1: 1bco A:481-560 [26431]
   Other proteins in same PDB: d1bcoa2

Details for d1bcoa1

PDB Entry: 1bco, 2.4 Å

PDB Description: bacteriophage mu transposase core domain

PDB Compounds: (A:) bacteriophage mu transposase

SCOPe Domain Sequences for d1bcoa1:

Sequence; same for both SEQRES and ATOM records:

>d1bcoa1 b.48.1.1 (A:481-560) mu transposase, C-terminal domain {Bacteriophage Mu [TaxId: 10677]}
teeqkrmlllpaeavnvsrkgeftlkvggslkgaknvyynmalmnagvkkvvvrfdpqql
hstvycytldgrficeaecl

Timeline for d1bcoa1:

• d1bcoa1 first appeared (with stable ids) in SCOP 1.55, called d1bco_1
  
• d1bcoa1 appears in SCOPe 2.05
  
• d1bcoa1 appears in SCOPe 2.07
  
• d1bcoa1 appears in the current release, SCOPe 2.08