Lineage for d1bco_1 (1bco 481-560)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15604Fold b.48: mu transposase, C-terminal domain [50609] (1 superfamily)
  4. 15605Superfamily b.48.1: mu transposase, C-terminal domain [50610] (1 family) (S)
  5. 15606Family b.48.1.1: mu transposase, C-terminal domain [50611] (1 protein)
  6. 15607Protein mu transposase, C-terminal domain [50612] (1 species)
  7. 15608Species Bacteriophage mu [TaxId:10677] [50613] (2 PDB entries)
  8. 15609Domain d1bco_1: 1bco 481-560 [26431]
    Other proteins in same PDB: d1bco_2

Details for d1bco_1

PDB Entry: 1bco (more details), 2.4 Å

PDB Description: bacteriophage mu transposase core domain

SCOP Domain Sequences for d1bco_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bco_1 b.48.1.1 (481-560) mu transposase, C-terminal domain {Bacteriophage mu}
teeqkrmlllpaeavnvsrkgeftlkvggslkgaknvyynmalmnagvkkvvvrfdpqql
hstvycytldgrficeaecl

SCOP Domain Coordinates for d1bco_1:

Click to download the PDB-style file with coordinates for d1bco_1.
(The format of our PDB-style files is described here.)

Timeline for d1bco_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bco_2