Lineage for d2hvga_ (2hvg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010496Species Plasmodium vivax [TaxId:5855] [267783] (2 PDB entries)
  8. 2010499Domain d2hvga_: 2hvg A: [264309]
    automated match to d4ffxc_
    complexed with so4

Details for d2hvga_

PDB Entry: 2hvg (more details), 2.3 Å

PDB Description: Crystal Structure of Adenylosuccinate Lyase from Plasmodium Vivax
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d2hvga_:

Sequence, based on SEQRES records: (download)

>d2hvga_ a.127.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
hlknispidgrykkacgelsaffsehalikhriivevrwllflneeelffekvtdhsvev
lnqiatnitdsdiarvkaieeetnhdvkaveyfvkeklknskredllkikeyvhylctse
dinnvayatclkaclndvvipclekimlklkdlaveyshvpllsrthgqpassttfgkem
anfyarihhhvgvirrvkvcakfngavgnfnahkvaskdtdwvntiglflkkhfnltysi
yctqiqdhdyicelcdglarangtlidlcvdiwlyisnnllklkvkekevgsstmphkvn
pidfenaegnlhianaffklfssklptsrlqrdlsdstvlrnigsslaycliayksvlkg
lnkididrrnleeelnqnwstlaepiqivmkrhnyvdayeelkqftrgkvidqkimqefi
ktkcaflpqdvvdqlleltpatytgyadylaknverls

Sequence, based on observed residues (ATOM records): (download)

>d2hvga_ a.127.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
hlknispidgrykkacgelsaffsehalikhriivevrwllflneeelffekvtdhsvev
lnqiatnitdsdiarvkaiehdvkaveyfvkeklknskredllkikeyvhylctsedinn
vayatclkaclndvvipclekimlklkdlaveyshvpllsrthgqpassttfgkemanfy
arihhhvgvirrvkvcakfngavgnfnahkvaskdtdwvntiglflkkhfnltysiyctq
iqdhdyicelcdglarangtlidlcvdiwlyisnnllklksstmphkvnpidfenaegnl
hianaffklfssklptsrlqrdlsdstvlrnigsslaycliayksvlkglnkididrrnl
eeelnqnwstlaepiqivmkrhnyvdayeelkqftrgkvidqkimqefiktkcaflpqdv
vdqlleltpatytgyadylaknverls

SCOPe Domain Coordinates for d2hvga_:

Click to download the PDB-style file with coordinates for d2hvga_.
(The format of our PDB-style files is described here.)

Timeline for d2hvga_: