SCOPe 2.06: Domain d2hpgd_: 2hpg D:

Lineage for d2hpgd_ (2hpg D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [267782] (1 PDB entry)

8. Domain d2hpgd_: 2hpg D: [264308]
   automated match to d4pdda_

Details for d2hpgd_

PDB Entry: 2hpg, 1.9 Å

PDB Description: The crystal structure of a thermophilic TRAP periplasmic binding protein

PDB Compounds: (D:) ABC transporter, periplasmic substrate-binding protein

SCOPe Domain Sequences for d2hpgd_:

Sequence; same for both SEQRES and ATOM records:

>d2hpgd_ c.94.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
fgakytlrfghvlapgepyhqaflkwakaveektngdvrievfpssqlgveediieqirm
gapvgwntdsarlgmyvkdigvmnlayfidfmgaktpeeaievlkkikqsptmqkwlkel
eqrfgikvlsfywvqgyrhfvtnkpirkpedlnglrirtpgapawqesirslgaipvavn
fgeiytavqtravdgaeltyanvyngglyevlkymsetghfllinfeivsadwfnslpke
yqkiieeemdkagievslkimkeleeeykqkciekgmavipaseidkeafmekakqaykn
lglenalnqlikevkg

Timeline for d2hpgd_:

• d2hpgd_ first appeared in SCOPe 2.05
  
• d2hpgd_ appears in SCOPe 2.07
  
• d2hpgd_ appears in the current release, SCOPe 2.08