Lineage for d2hpgc_ (2hpg C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146280Species Thermotoga maritima [TaxId:2336] [267782] (1 PDB entry)
  8. 2146283Domain d2hpgc_: 2hpg C: [264307]
    automated match to d4pdda_

Details for d2hpgc_

PDB Entry: 2hpg (more details), 1.9 Å

PDB Description: The crystal structure of a thermophilic TRAP periplasmic binding protein
PDB Compounds: (C:) ABC transporter, periplasmic substrate-binding protein

SCOPe Domain Sequences for d2hpgc_:

Sequence, based on SEQRES records: (download)

>d2hpgc_ c.94.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
gakytlrfghvlapgepyhqaflkwakaveektngdvrievfpssqlgveediieqirmg
apvgwntdsarlgmyvkdigvmnlayfidfmgaktpeeaievlkkikqsptmqkwlkele
qrfgikvlsfywvqgyrhfvtnkpirkpedlnglrirtpgapawqesirslgaipvavnf
geiytavqtravdgaeltyanvyngglyevlkymsetghfllinfeivsadwfnslpkey
qkiieeemdkagievslkimkeleeeykqkciekgmavipaseidkeafmekakqayknl
glenalnqlikevkge

Sequence, based on observed residues (ATOM records): (download)

>d2hpgc_ c.94.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
gakytlrfghvlapgepyhqaflkwakaveektngdvrievfpssqlgveediieqgapv
gwntdsarlgmyvkdigvmnlayfidfmgaktpeeaievlkkikqsptmqkwlkeleqrf
gikvlsfywvqgyrhfvtnkpirkpedlnglrirtpgapawqesirslgaipvavnfgei
ytavqtravdgaeltyanvyngglyevlkymsetghfllinfeivsadwfnslpkeyqki
ieeemdkagievslkimkeleeeykqkciekgmavipaseidkeafmekakqayknlgle
nalnqlikevkge

SCOPe Domain Coordinates for d2hpgc_:

Click to download the PDB-style file with coordinates for d2hpgc_.
(The format of our PDB-style files is described here.)

Timeline for d2hpgc_: