Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Onchocerca volvulus [TaxId:6282] [267781] (1 PDB entry) |
Domain d2hnlb2: 2hnl B:102-225 [264303] Other proteins in same PDB: d2hnla1, d2hnlb1 automated match to d1zl9a2 complexed with gsh |
PDB Entry: 2hnl (more details), 2 Å
SCOPe Domain Sequences for d2hnlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnlb2 a.45.1.0 (B:102-225) automated matches {Onchocerca volvulus [TaxId: 6282]} lgtndweeakimavvlnidelfqklipwtheknttkkaelfrnlsesdvmpflgryekfl kesttghivgnkvsvadltvfnmlmtlddevkleeypqlasfvnkigqmpgikewikkrp ktyf
Timeline for d2hnlb2: