Lineage for d2hnlb2 (2hnl B:102-225)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 2000050Species Onchocerca volvulus [TaxId:6282] [267781] (1 PDB entry)
  8. 2000052Domain d2hnlb2: 2hnl B:102-225 [264303]
    Other proteins in same PDB: d2hnla1, d2hnlb1
    automated match to d1zl9a2
    complexed with gsh

Details for d2hnlb2

PDB Entry: 2hnl (more details), 2 Å

PDB Description: structure of the prostaglandin d synthase from the parasitic nematode onchocerca volvulus
PDB Compounds: (B:) Glutathione S-transferase 1

SCOPe Domain Sequences for d2hnlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnlb2 a.45.1.0 (B:102-225) automated matches {Onchocerca volvulus [TaxId: 6282]}
lgtndweeakimavvlnidelfqklipwtheknttkkaelfrnlsesdvmpflgryekfl
kesttghivgnkvsvadltvfnmlmtlddevkleeypqlasfvnkigqmpgikewikkrp
ktyf

SCOPe Domain Coordinates for d2hnlb2:

Click to download the PDB-style file with coordinates for d2hnlb2.
(The format of our PDB-style files is described here.)

Timeline for d2hnlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hnlb1