SCOPe 2.08: Domain d2hnla2: 2hnl A:102-225

Lineage for d2hnla2 (2hnl A:102-225)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Onchocerca volvulus [TaxId:6282] [267781] (1 PDB entry)

8. Domain d2hnla2: 2hnl A:102-225 [264301]
   Other proteins in same PDB: d2hnla1, d2hnlb1
   automated match to d1zl9a2
   complexed with gsh

Details for d2hnla2

PDB Entry: 2hnl, 2 Å

PDB Description: structure of the prostaglandin d synthase from the parasitic nematode onchocerca volvulus

PDB Compounds: (A:) Glutathione S-transferase 1

SCOPe Domain Sequences for d2hnla2:

Sequence; same for both SEQRES and ATOM records:

>d2hnla2 a.45.1.0 (A:102-225) automated matches {Onchocerca volvulus [TaxId: 6282]}
lgtndweeakimavvlnidelfqklipwtheknttkkaelfrnlsesdvmpflgryekfl
kesttghivgnkvsvadltvfnmlmtlddevkleeypqlasfvnkigqmpgikewikkrp
ktyf

Timeline for d2hnla2:

• d2hnla2 first appeared in SCOPe 2.05
  
• d2hnla2 appears in SCOPe 2.07