SCOP 1.67: Domain d2hrvb_: 2hrv B:

Lineage for d2hrvb_ (2hrv B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein 2A cysteine proteinase [50607] (1 species)

7. Species Human rhinovirus 2 [TaxId:12130] [50608] (1 PDB entry)

8. Domain d2hrvb_: 2hrv B: [26430]
   complexed with zn

Details for d2hrvb_

PDB Entry: 2hrv, 1.95 Å

PDB Description: 2a cysteine proteinase from human rhinovirus 2

SCOP Domain Sequences for d2hrvb_:

Sequence; same for both SEQRES and ATOM records:

>d2hrvb_ b.47.1.4 (B:) 2A cysteine proteinase {Human rhinovirus 2}
gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
taggdnhvafidlrhfhca

Timeline for d2hrvb_:

• d2hrvb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hrvb_ appears in SCOP 1.65
  
• d2hrvb_ appears in SCOP 1.69
  
• d2hrvb_ appears in the current release, SCOPe 2.08