SCOPe 2.05: Domain d2g6vb2: 2g6v B:147-367

Lineage for d2g6vb2 (2g6v B:147-367)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267778] (1 PDB entry)

8. Domain d2g6vb2: 2g6v B:147-367 [264291]
   Other proteins in same PDB: d2g6va1, d2g6vb1
   automated match to d2b3za1

Details for d2g6vb2

PDB Entry: 2g6v, 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6vb2:

Sequence; same for both SEQRES and ATOM records:

>d2g6vb2 c.71.1.0 (B:147-367) automated matches {Escherichia coli [TaxId: 562]}
pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv
rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet
vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll
gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga

Timeline for d2g6vb2:

• d2g6vb2 is new in SCOPe 2.05-stable
  
• d2g6vb2 appears in SCOPe 2.06
  
• d2g6vb2 appears in the current release, SCOPe 2.08