Lineage for d2hrva_ (2hrv A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671623Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 671624Protein 2A cysteine proteinase [50607] (1 species)
  7. 671625Species Human rhinovirus 2 [TaxId:12130] [50608] (1 PDB entry)
  8. 671626Domain d2hrva_: 2hrv A: [26429]

Details for d2hrva_

PDB Entry: 2hrv (more details), 1.95 Å

PDB Description: 2a cysteine proteinase from human rhinovirus 2
PDB Compounds: (A:) 2a cysteine proteinase

SCOP Domain Sequences for d2hrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrva_ b.47.1.4 (A:) 2A cysteine proteinase {Human rhinovirus 2 [TaxId: 12130]}
gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
taggdnhvafidlrhfhca

SCOP Domain Coordinates for d2hrva_:

Click to download the PDB-style file with coordinates for d2hrva_.
(The format of our PDB-style files is described here.)

Timeline for d2hrva_: