Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein 2A cysteine proteinase [50607] (1 species) |
Species Human rhinovirus 2 [TaxId:12130] [50608] (1 PDB entry) |
Domain d2hrva_: 2hrv A: [26429] |
PDB Entry: 2hrv (more details), 1.95 Å
SCOP Domain Sequences for d2hrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrva_ b.47.1.4 (A:) 2A cysteine proteinase {Human rhinovirus 2} gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv taggdnhvafidlrhfhca
Timeline for d2hrva_: