Lineage for d2g6va2 (2g6v A:147-367)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872337Species Escherichia coli [TaxId:562] [267778] (1 PDB entry)
  8. 1872338Domain d2g6va2: 2g6v A:147-367 [264289]
    Other proteins in same PDB: d2g6va1, d2g6vb1
    automated match to d2b3za1

Details for d2g6va2

PDB Entry: 2g6v (more details), 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli
PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6va2:

Sequence, based on SEQRES records: (download)

>d2g6va2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 562]}
pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv
rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet
vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll
gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga

Sequence, based on observed residues (ATOM records): (download)

>d2g6va2 c.71.1.0 (A:147-367) automated matches {Escherichia coli [TaxId: 562]}
pyiqlklgasldgrtamesqwitspqarrdvqllraqshailtssatvladdpaltvrws
eldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpetvrt
llipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkllgsd
arglctlpgpqfkfkeirhvgpdvclhlvga

SCOPe Domain Coordinates for d2g6va2:

Click to download the PDB-style file with coordinates for d2g6va2.
(The format of our PDB-style files is described here.)

Timeline for d2g6va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g6va1