SCOPe 2.07: Domain d2eo6a1: 2eo6 A:8-135

Lineage for d2eo6a1 (2eo6 A:8-135)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)

8. Domain d2eo6a1: 2eo6 A:8-135 [264283]
   Other proteins in same PDB: d2eo6a2, d2eo6a3
   automated match to d2dm0a_

Details for d2eo6a1

PDB Entry: 2eo6

PDB Description: solution structure of the sh2 domain from mouse b-cell linker protein blnk

PDB Compounds: (A:) B-cell linker protein

SCOPe Domain Sequences for d2eo6a1:

Sequence; same for both SEQRES and ATOM records:

>d2eo6a1 d.93.1.0 (A:8-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pfnstfadqeaellgkpwyagacdrksaeealhrsnkdgsflirkssghdskqpytlvaf
fnkrvynipvrfieatkqyalgkkkngeeyfgsvveivnshqhnplvlidsqnntkdstr
lkyavkvs

Timeline for d2eo6a1:

• d2eo6a1 first appeared in SCOPe 2.05, called d2eo6a_
  
• d2eo6a1 appears in SCOPe 2.06
  
• d2eo6a1 appears in the current release, SCOPe 2.08