Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries) |
Domain d2eo6a1: 2eo6 A:8-135 [264283] Other proteins in same PDB: d2eo6a2, d2eo6a3 automated match to d2dm0a_ |
PDB Entry: 2eo6 (more details)
SCOPe Domain Sequences for d2eo6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eo6a1 d.93.1.0 (A:8-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pfnstfadqeaellgkpwyagacdrksaeealhrsnkdgsflirkssghdskqpytlvaf fnkrvynipvrfieatkqyalgkkkngeeyfgsvveivnshqhnplvlidsqnntkdstr lkyavkvs
Timeline for d2eo6a1: