Lineage for d2eo6a1 (2eo6 A:8-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2531028Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)
  8. 2531033Domain d2eo6a1: 2eo6 A:8-135 [264283]
    Other proteins in same PDB: d2eo6a2, d2eo6a3
    automated match to d2dm0a_

Details for d2eo6a1

PDB Entry: 2eo6 (more details)

PDB Description: Solution structure of the SH2 domain from mouse B-cell linker protein BLNK
PDB Compounds: (A:) B-cell linker protein

SCOPe Domain Sequences for d2eo6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eo6a1 d.93.1.0 (A:8-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pfnstfadqeaellgkpwyagacdrksaeealhrsnkdgsflirkssghdskqpytlvaf
fnkrvynipvrfieatkqyalgkkkngeeyfgsvveivnshqhnplvlidsqnntkdstr
lkyavkvs

SCOPe Domain Coordinates for d2eo6a1:

Click to download the PDB-style file with coordinates for d2eo6a1.
(The format of our PDB-style files is described here.)

Timeline for d2eo6a1: