Lineage for d2egea1 (2ege A:8-75)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377559Species Human (Homo sapiens) [TaxId:9606] [187598] (92 PDB entries)
  8. 2377661Domain d2egea1: 2ege A:8-75 [264279]
    Other proteins in same PDB: d2egea2
    automated match to d2csia_

Details for d2egea1

PDB Entry: 2ege (more details)

PDB Description: Solution structure of the third SH3 domain from human KIAA1666 protein
PDB Compounds: (A:) Uncharacterized protein KIAA1666

SCOPe Domain Sequences for d2egea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egea1 b.34.2.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kimiaaldydpgdgqmggqgkgrlalragdvvmvygpmddqgfyygelgghrglvpahll
dhmslhgh

SCOPe Domain Coordinates for d2egea1:

Click to download the PDB-style file with coordinates for d2egea1.
(The format of our PDB-style files is described here.)

Timeline for d2egea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2egea2