SCOPe 2.07: Domain d2edqa1: 2edq A:8-101

Lineage for d2edqa1 (2edq A:8-101)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2edqa1: 2edq A:8-101 [264273]
   Other proteins in same PDB: d2edqa2, d2edqa3
   automated match to d2edfa_

Details for d2edqa1

PDB Entry: 2edq

PDB Description: solution structure of the ig-like domain (3713-3806) of human obscurin

PDB Compounds: (A:) Obscurin

SCOPe Domain Sequences for d2edqa1:

Sequence; same for both SEQRES and ATOM records:

>d2edqa1 b.1.1.0 (A:8-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pskfieglrneeategdtatlwcelskaapvewrkghetlrdgdrhslrqdgsrcelqir
glavvdageyscvcgqertsatltvralparfie

Timeline for d2edqa1:

• d2edqa1 first appeared in SCOPe 2.05, called d2edqa_
  
• d2edqa1 appears in SCOPe 2.06
  
• d2edqa1 appears in the current release, SCOPe 2.08