SCOPe 2.05: Domain d2edha_: 2edh A:

Lineage for d2edha_ (2edh A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2edha_: 2edh A: [264271]
   automated match to d2edfa_

Details for d2edha_

PDB Entry: 2edh

PDB Description: Solution structure of the PDZ domain (3614- 3713 ) from human obscurin

PDB Compounds: (A:) Obscurin

SCOPe Domain Sequences for d2edha_:

Sequence; same for both SEQRES and ATOM records:

>d2edha_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgrtsamltvralpikfteglrneeategatavlrcelskmapvewwkghetlrd
gdrhslrqdgarcelqirglvaedageylcmcgkertsamltvrampsgpssg

Timeline for d2edha_:

• d2edha_ is new in SCOPe 2.05-stable
  
• d2edha_ is called d2edha1 in SCOPe 2.06
  
• d2edha_ appears in the current release, SCOPe 2.08, called d2edha1