Lineage for d2ecla1 (2ecl A:8-81)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264199Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 2264200Protein automated matches [190242] (3 species)
    not a true protein
  7. 2264203Species Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries)
  8. 2264212Domain d2ecla1: 2ecl A:8-81 [264270]
    Other proteins in same PDB: d2ecla2
    automated match to d4p5ob_
    complexed with zn

Details for d2ecla1

PDB Entry: 2ecl (more details)

PDB Description: solution structure of the ring domain of the human ring-box protein 2
PDB Compounds: (A:) RING-box protein 2

SCOPe Domain Sequences for d2ecla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecla1 g.44.1.0 (A:8-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mwswdvecdtcaicrvqvmdaclrcqaenkqedcvvvwgecnhsfhnccmslwvkqnnrc
plcqqdwvvqrigk

SCOPe Domain Coordinates for d2ecla1:

Click to download the PDB-style file with coordinates for d2ecla1.
(The format of our PDB-style files is described here.)

Timeline for d2ecla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ecla2